PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_4752_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 556aa    MW: 60858.5 Da    PI: 7.0207
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_4752_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.19.1e-42174249277
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          Cqv+gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk
  cra_locus_4752_iso_3_len_2618_ver_3 174 CQVHGCKKDLSSSKDYHKRHKVCEIHSKTAKVIVNGTEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRK 247
                                          ************************************************************************** PP

                                          -- CS
                                  SBP  76 kq 77 
                                          ++
  cra_locus_4752_iso_3_len_2618_ver_3 248 PH 249
                                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-34167235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.684171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-39172252IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MESWSYISGG KNFVSDESVS ATDGIARGKN GFMGWDLKSS SSFENISLMC SSQEGIKNQE  60
FIELGSSDMI RKSLVNDSIT DVFSSQYGYG RVYNPVTAPP NTVSGEEESS SKLSSSIVDS  120
NCWDSSLIDL KLGRFPDHKD VQPKVNASNF SSTESPIPTK RARAGSLSSQ TPFCQVHGCK  180
KDLSSSKDYH KRHKVCEIHS KTAKVIVNGT EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG  240
HNERRRKPHI GMHSGRAGRL FQSYNGTRYQ GTSFALSSFV CQDILPGSLL HQQKCEMNDW  300
YKNVKVEDEA DYSPQLGIPN TKGQTHSKSH LTSFSAEKQC PPSMHDDGLI AVTRSEMQEN  360
SNSFLHSMST SDFDSRSLFN NSSLGNEELT VLDSSSTVQG LPALSSSGCA LSLLSSQPQK  420
SSNQSSGIPT ALPLITPSSH SHYNVTQVSE KLMRVSPQTS TSGVSNAFHS SGINSTEETQ  480
MEPILMSDGI DSVSYGINGI IHGSGYINAK DSVSCGDGSS TIDLLQLSSQ LQRVEHQRQS  540
MQVKQETDAF FGLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29168247584squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037628.10.0LIGULELESS1 protein, putative
TrEMBLA0A061G5240.0A0A061G524_THECC; LIGULELESS1 protein, putative
STRINGVIT_17s0000g05020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639